Eye Frames Per Second
for sale

Faleemi 720P Pan/Tilt Wireless WiFi IP Camera, Home Security Surveillance Video Camera with Two Way Audio, Night Vision for Baby/Elder/Pet/Nanny/Office Monitor FSC776B Nanny Cam (Black) $79.99

Faleemi 720P Pan/Tilt Wireless WiFi IP Camera, Home Security Surveillance Video Camera with Two...

Details...
Save 50%
Faleemi 720P Pan/Tilt Wireless WiFi IP Camera, Home Security Surveillance Video Camera with Two Way Audio, Night Vision for Baby/Elder/Pet/Nanny/Office Monitor FSC776W (White) $79.99

Faleemi 720P Pan/Tilt Wireless WiFi IP Camera, Home Security Surveillance Video Camera with Two...

Details...
Save 50%
Elgato Game Capture 4K60 Pro, 4K 60fps capture card with ultra-low latency technology for recording and streaming, PCIe x4 $403.17

Elgato Game Capture 4K60 Pro, 4K 60fps capture card with ultra-low latency technology for...

Details...
M&F INNOV| Hidden Surveillance Camera |Motion Camera USB Charger| HD 1080P| 32GB (included) + (FREE) 3-In-1 Charger Cable|Nanny Spy Camera $39.88

M&F INNOV| Hidden Surveillance Camera |Motion Camera USB Charger| HD 1080P| 32GB (included) +...

Details...
Faleemi 1080P Full HD Pan/Tilt Wireless WiFi IP Camera, Security Camera with Two Way Audio, Night Vision/Memory Card Slot/Plug/Play for Baby/Elder/Pet/Nanny/Garage/Office Monitor FSC880 $137.99

Faleemi 1080P Full HD Pan/Tilt Wireless WiFi IP Camera, Security Camera with Two Way Audio, Night...

Details...
Save 51%
Hykamic Outdoor 4 Megapixels PoE Dome IP Security Camera-  IP66 Weatherproof, 2K HD (2.8mm Lens) $86.90

Hykamic Outdoor 4 Megapixels PoE Dome IP Security Camera- IP66 Weatherproof, 2K HD (2.8mm Lens)

Details...
GoPro HERO 4 Silver Edition 12MP Waterproof Sports & Action Camera Bundle with 2 Batteries $422.99

GoPro HERO 4 Silver Edition 12MP Waterproof Sports & Action Camera Bundle with 2 Batteries

Details...
Save 15%
LucidCam: World’s First True Virtual Reality 3D 4K Camera Captures Life from Your Perspective $499.99

LucidCam: World’s First True Virtual Reality 3D 4K Camera Captures Life from Your Perspective

Details...

Latest Video

So wait...what's the frame rate of our eyes?

Cameras, movies, computers, and televisions all work on the principle of frames to create the illusion of motion. So...what about our eyes? Do they have a frame ...

News & Reviews

[11/25/17, via ]
This RSS feed URL is deprecated [...]

[11/25/17, via Digital Journal]
High-Speed Camera Market Size Will Grow at a Robust Pace Through 2021 High-speed cameras can analyze invisible objects which are beyond the capacity of human eye. The quality of a high-speed camera is determined by various attributes such as, frame rates, resolution, memory size, battery, image processing, and light [...]

Gizmodo [11/24/17, via Gizmodo]
GoPro's Hero6 Is the King of Action That means it can shoot 4K video at 60 frames per second and 1080p at 240fps. My final videos are typically 24fps (it Moments that pass by in an instant are suddenly clearly preserved in a way that your eye can appreciate. Water takes on a whole [...]

NBC 5 Dallas-Fort Worth [11/22/17, via NBC 5 Dallas-Fort Worth]
Searching for 'Truth' in the Moving Image at the Dallas Museum of Art Can truth be found in a film in the current era of "fake news?" The Dallas Museum of Art explores that question with Truth: 24 frames per second, its first major exhibition dedicated to time-based media. On view through January 28, the exhibition [...]

WIRED [11/03/17, via WIRED]
Don't Pay Verizon's $10 'Premium Video' Upcharge On a 5.5-inch display with a 16:9 aspect ratio, like you'd find the iPhone 8, 720p has 267 ppi, meaning that it falls close enough to the visual acuity of the human eye that you're unlikely to notice a difference in practice. For a 6-inch phone with an [...]

Eye Frames Per Second

Frame rate (also known as frame frequency) is the frequency (rate) at which an imaging device produces unique consecutive images called frames. The term applies equally well to computer graphics, video cameras, film cameras, and motion capture systems. Frame rate is most often expressed in frames per second (FPS) and is also expressed in progressive scan monitors as hertz (Hz).
The human eye and its brain interface, the human visual system, can process 10 to 12 separate images per second, perceiving them individually. The visual cortex holds onto one image for about one-fifteenth of a second, so if another image is received during that period an illusion of continuity is created, allowing a sequence of still images to give the impression of motion. Early silent films had a frame...

Source: Freebase, licensed under CC-BY.

@Dmikesouz Ballin’ on a budget my friend! Haha... We have the best camera iPad (gets 130 frames per second) we use… t.co/wfWE32E1JG 

@DasSurma > The human eye can only see like 18 frames per second anyways, right? I don't think that's correct. I th… t.co/3Pvbkbb7H6 

RT @pupil_labs: We are excited to announce brand new eye tracking cameras designed and developed by Pupil Labs. Faster, smaller, lighter -…

RT @pupil_labs: We are excited to announce brand new eye tracking cameras designed and developed by Pupil Labs. Faster, smaller, lighter -…

@lilmadasiangirl @WUTERIX frames per second ??? (wide eye emoji)

Popular Photography - ND Popular Photography - ND
1950
ISBN
248 pages
Popular Photography - ND Popular Photography - ND
1951
ISBN
216 pages
Introduction to Light Introduction to Light
Published by Courier Corporation 2016
ISBN 048642118X,9780486421186
228 pages
Popular Photography - ND Popular Photography - ND
1948
ISBN
260 pages

Sony to deliver PlayStation VR in October

art vancouver gallery photographer science ron anatomy facebook nutrition intensive effective classschedule twitter sombilon bishnughosh photographyistheprocess activityandartofcreatingstillormovingpicturesbyrecordingradiationonaradiationsensitivemedium suchasaphotographicfilm oranelectronicsensorlightpatternsreflectedoremittedfromobjectsactivateasensitivechemicalorelectronicsensorduringatimedexposure usuallythroughaphotographiclensinadeviceknownasacamerathatalsostorestheresultinginformationchemicallyorelectronicallyphotographyhasmanyusesforbusiness togethermeaningdrawingwithlight1traditionally theproductsofphotographyhavebeencallednegativesandphotographs commonlyshortenedtophotosfunctionthecameraorcameraobscuraistheimageformingdevice andphotographicfilmorasiliconelectronicimagesensoristhesensingmediumtherespectiverecordingmediumcanbethefilmitself oradigitalelectronicormagneticmemoryphotographerscontrolthecameraandlenstoexposethelightrecordingmaterialsuchasfilmtotherequiredamountoflighttoformalatentimageonfilmorrawfileindigitalcameraswhich afterappropriateprocessing isconvertedtoausableimagedigitalcamerasuseanelectronicimagesensorbasedonlightsensitiveelectronicssuchaschargecoupleddeviceccdorcomplementarymetaloxidesemiconductorcmostechnologytheresultingdigitalimageisstoredele butcanbereproducedonpaperorfilmthemoviecameraisatypeofphotographiccamerawhichtakesarapidsequenceofphotographsonstripsoffilmincontrasttoastillcamera whichcapturesasinglesnapshotatatime themoviecameratakesaseriesofimages eachcalledaframethisisaccomplishedthroughanintermittentmechanismtheframesarelaterplayedbackinamovieprojectorataspecificspeed calledtheframeratenumberofframespersecondwhileviewing apersonseyesandbrainmergetheseparatepicturestogethertocreatetheillusionofmotion2inallbutcertainspecializedcameras theprocessofobtainingausableexposuremustinvolvetheuse manuallyorautomatically ofafewcontrolstoensurethephotographisclear sharpandwellilluminatedthecontrolsusuallyincludebutarenotlimitedtothefollowing commonlyknownashotyoga yogirajbikramchoudhuryisthefounderoftheworldwideyogacollegeofindia™bornincalcuttain1946 bikrambeganyogaattheageoffourwithindiasmostrenownedphysicalculturistatthattime theyoungerbrotherofparamahansayoganandaauthorofthemostpopularbookonyoga theautobiographyofayogi andfounderoftheselfrealizationfellowshipinlosangelesbikrampracticedyogaatleastfourtosixhourseverydayatghoshscollegeofphysicaleducationincalcuttaattheageofthirteen hewonthenationalindiayogachampionshiphewasundefeatedforthefollowingthreeyearsandretiredastheundisputedallindianationalyogachampionatseventeen aninjurytohiskneeduringaweightliftingaccidentbroughtthepredictionfromleadingeuropeandoctorsthathewouldneverwalkagainnotacceptingtheirpronouncement hehadhimselfcarriedbacktobishnughoshsschool forheknewthatifanyonecouldhelptohealhisknee itwashisteachersixmonthslater thefreeencyclopediabikramyoga isasystemofyogathatbikramchoudhurysynthesizedfromtraditionalyogatechniquesandpopularizedbeginninginenwikipediaorgwikibikramyogacachedsimilarultimatehealthwithbikramyogainformationonlocation andcostvancouverwwwbikramyogavancouvercomcachedsimilar bikramyogateachertrainingprogramisthemostexciting amusingandglamorousyogaclassintheworldspendnineweeksimmersedinanindepthstudyofbikramyogawithyogamastersbikramandrajashreechoudhuryandtheirstaffofseniorteachersthecourse leadingtoacertificateofcompletion willintroduceyoutothebasicknowledgeneededtobeginteachingthispowerfulhealingyogathecoursecoversasana therapeuticapplicationsandhealthbenefitsofyoga philosophyofyoga bikramspostureclinic andthebikramyogadialoguethroughdedicatedpracticeandstudyofthe26postures youwillexpandyourknowledgeofthebikrammethodandprepareyourselftoteachit httpwwwmsnbcmsncomid21134540vp4276327942763279 Photo by SOMBILON PHOTOGRAPHY | GALLERY | VIDEOGRAPHY on Flickr

By the end of the year — indeed, by Christmas time — it’s highly possible that we’ll see virtual reality become the new present battleground, because Sony is about to join the other gaming players that are Oculus and HTC with its own virtual... But while Oculus and the power-team of HTC and Valve will require a pretty highly spec’d computer to make its VR headsets work, Sony’s aptly named PlayStation VR will require only the aforementioned VR helmet and a PlayStation 4. Once you have...

[via Gadget Guy Australia]

IKEA thoughts and some of my favorite items from IKEA

wood autumn tree love nature germany deutschland ngc herbst natur arbres 25 e topf fv10 faves rhine wald rhein arbre baum breathtaking tra lorch sogno myheart wow1 wow2 wow3 mfcc realta welcometoparadise supershot topshots 3000v120f naturepoetry frameit top20clonepics supershots wasset asquare energiapositiva highqualityimages natureselegantshots 100commentgroup thebestofmimamorsgroups astrattoedintorni energiapositivanatureza umolhovêooutrosente virgiliocompany mygearandmesilver mygearandmegold mygearandmeplatinum mygearandmediamond wowbrilliant asquarelegend lélitedespaysages cluboftheprestigecolorfullandscapecreativeoutburstscreativephotogroupdontworrybehappydoublethebeautydoubledbeautiesdramajoinusdreams uniquementlordbyronlovewithgoldribbonslovelyuniversemagicunicornmagicalmomentsmeupaísémuseed’artmodernemuseumqualityonlymysoul myartnaturenaturesprimenaturesprimehalloffamenewgoldsealofqualityonlylandscapeandsunsetpanemetcircensespeacetookovermyheartphotogallerypioneerincreativity goldenachievement lifeearthcreatesearthnatureloveecoledesbeauxartselegantphotoartexcellentexpositiodesartscontemporainextraordinarilyimpressivefantasticnaturegalleryfavoritesthebestphotosfeedthesoulfinestgoldfinestnatu fleursetpaysagesflickrdiamondflickrbronzesilvergoldtrophygroupflickrspictureperfectflickrsfav250forgottentreasuresfrancostopgallerygalleryofdreamsgoldsealingshealinglightofthespiritineedatreeiwannabe magicmomentsinyourlife me2youphotographylevel1 vpu2 vpu3 vpu9 vpu10 frameitlevel3 frameitlevel2 frameitlevel4 frameitlevel5 frameitlevel6 frameitlevel7 Photo by Mister-Mastro on Flickr

I wasn't really sure what all the hype was about because from my knowledge, IKEA was the place were you bought cheap particle board furniture. I still don't like all the particle board stuff but my opinions have changed when I realized they have a lot more to offer than cheap tables and bookshelves. Over the past three years, I have purchased some IKEA stuff that I am a big fan of and there are still some other things that I have my eye on (looking to add to a registry perhaps. I got it to put over my white duvet that I had got from my grandma when she got a smaller bed. I was wary of the white color but have kept it clean by avoiding eating in bed and doing homework on bed. I have some holding miscellaneous craft supplies and some holding pasta. They are great for storing kitchen items like pasta and pretzels but I wouldn't recommend them for.

[via Sent by Sarah]

[03/15/16, via SpaceRef]
Stunning Video: Solar Dynamics Observatory Year 6 Ultra-HD Launched on Feb. 11, 2010, SDO keeps a 24-hour eye on the entire disk of the sun ... At full quality on YouTube, this video is ultra-high definition 3840x2160 and 29.97 frames per second. Each frame represents 2 hours. A downloadable version has a frame ... [...]

[03/15/16, via Gamasutra]
Shiny: From Oculus Rift to GearVR You want your app to run with 75 frames/second, especially if you use the Oculus Rift pointer ... So all in all just try to be below 13.3 milliseconds per frame. When using the Unity Inspector and looking out for spikes in the framerate, you will often ... [...]

[03/15/16, via What Culture]
11 Totally Mesmerising Slow-Mo Videos Normal footage is recorded at around 24 frames-per-second. High speed cameras can capture as many ... kind of exquisite detail that just wouldn’t be possible with the naked eye. Plus, it looks really cool when you blow things up. They’re always doing ... [...]

[03/13/16, via MENAFN]
iXCC Releases New Professional Gaming Mouse Offering 6600 frames per second and smooth and responsive tracking to deliver an ... MENA News Headlines Mar 12 2016 - Egypt- CI Capital, Beltone eye acquisition of electronic brokerage company, Daily News Egypt (MENAFN - Daily News Egypt) Following ... [...]

[03/13/16, via Mashable]
Voxiebox makes virtual reality without goggles Unless, that is, you're using Voxiebox, which employs biology and physics to create live holograms that you can see with your naked eye, walk around ... up and down at a rate of roughly 3,000 frames per second. Suddenly, in place of the screen is a ... [...]

Sony a7R III promises faster bursts, better focusing and longer battery life

Sony has announced the a7R Mark III, a 42.4MP mirrorless camera built around the lessons learned from its flagship a9 sports camera. The result is a high-res full frame camera capable of 10 fps shooting with more tenacious autofocus and many of the improvements existing a7R II users had hoped for.The camera features essentially the same body as the a7R II, but Sony has found room for a focus point selection joystick, AF-On button, twin SD card slots, flash sync socket and, most importantly,...

Best GoPro Hero 6 Black Friday & Cyber Monday Deals of 2017 Revealed by Eye See 360

Online shopping comparison website Eye See 360 have announced the best GoPro Hero 6 Black Friday 2017 discounts available.Deals analysts at Eye See 360 are comparing and recording the best GoPro Hero 6 Black Friday deals. The following have been identified as the most popular deals for 2017:The first GoPro camera capable of shooting 4K video at 60 frames per second, the Hero 6 Black camera is the highest spec GoPro ever made. Whilst it has the same waterproof design as the Hero 5 Black, the...

Blackvue DR750S-2CH dash cam review: A clever, high-quality two-camera bundle

The Blackvue DR750S-2CH dash cam impressed us right out of the box. With similarly-styled front and rear cameras, a clever mounting system, and tubular good looks, it just looks like it will do its job well. It can also be accessed from across the Internet and uses Wi-Fi to communicate with the company’s Android and iOS apps.But you pay for all the goodies: At $399 ($283 without the rear camera), the DR750S-2CH plays in the same rarefied pricing sphere as Thinkware’s top-of-the-line cameras....