Eye Frames Per Second
for sale

Faleemi Pan/Tilt Wireless IP Camera, Home Security Surveillance System 720P with Two Way Audio, Night Vision Remote Control for Baby/Elder/Pet/Office Monitor Nanny Cam FSC776B (Black) $79.99

Faleemi Pan/Tilt Wireless IP Camera, Home Security Surveillance System 720P with Two Way Audio,...

Details...
Save 50%
Elgato Game Capture 4K60 Pro, 4K 60fps capture card with ultra-low latency technology for recording PS4 Pro and Xbox One X gameplay, PCIe x4 $399.95

Elgato Game Capture 4K60 Pro, 4K 60fps capture card with ultra-low latency technology for...

Details...
Faleemi Pan/Tilt Wireless IP Camera, Home Security Surveillance System 720P with Two Way Audio, Night Vision Remote Control for Baby/Elder/Pet/Office Monitor Nanny Cam FSC776W (White) $79.99

Faleemi Pan/Tilt Wireless IP Camera, Home Security Surveillance System 720P with Two Way Audio,...

Details...
Save 50%
32GB Hidden Camera Power Bank,DigiHero Power Bank with 1080P Hidden Camera - Motion Detective - Loop Recording -32GB Memory- Perfect Covert Security Camera for Home and Office - NO WIFI $73.99

32GB Hidden Camera Power Bank,DigiHero Power Bank with 1080P Hidden Camera - Motion Detective -...

Details...
Canon EOS Rebel T6 DSLR 18mp WiFi Enabled + EF-S 18-55mm IS [Image Stabilizer] II Zoom Lens + Canon Professional Gadget Bag + Commander 32GB Class 10 Ultra High Speed Memory Card $549.00

Canon EOS Rebel T6 DSLR 18mp WiFi Enabled + EF-S 18-55mm IS [Image Stabilizer] II Zoom Lens +...

Details...
Nikon D7100 24.1 MP DX-Format CMOS Digital SLR (Body Only) $699.00

Nikon D7100 24.1 MP DX-Format CMOS Digital SLR (Body Only)

Details...
Save 13%
Faleemi 1080P Full HD Pan/Tilt Wireless WiFi IP Camera, Security Camera with Two Way Audio, Night Vision/Memory Card Slot/Plug/Play for Baby/Elder/Pet/Nanny/Garage/Office Monitor FSC880 $137.99

Faleemi 1080P Full HD Pan/Tilt Wireless WiFi IP Camera, Security Camera with Two Way Audio, Night...

Details...
Save 54%
LucidCam: World’s First True Virtual Reality 3D 4K Camera Captures Life from Your Perspective $499.99

LucidCam: World’s First True Virtual Reality 3D 4K Camera Captures Life from Your Perspective

Details...

Latest Video

So wait...what's the frame rate of our eyes?

Cameras, movies, computers, and televisions all work on the principle of frames to create the illusion of motion. So...what about our eyes? Do they have a frame ...

News & Reviews

[02/13/18, via ]
This RSS feed URL is deprecated [...]

Digital Trends [02/13/18, via Digital Trends]
Want to shoot like a street photographer? The compact Panasonic GX9 is your tool Panasonic's Depth From Defocus autofocus system allows for communication between camera and lens as fast as 240 fps, with an autofocus speed of 0.07 seconds. Panasonic improved the tracking performance by integrating 3D measurement of the entire scene [...]

Motherboard [01/18/18, via Motherboard]
This Is What 'Super Mario' Looks Like at 380000 Frames Per Second C'mon, let's be honest with ourselves) works. Then they train their slow-mo cameras on an old cathode ray tube television playing the original Super Mario Bros. and things get magical. Old TVs render an image by actually drawing the entire frame from [...]

Ars Technica [01/22/18, via Ars Technica]
Video demonstrates the marvel of CRT displays at 380000 frames per second We spend a lot of time reading about the differences between display technologies like LCD and OLED, which, like all display technologies, are built to fool our eyes into seeing things that are only simulated, not real, like colors, or realistic [...]

imaging resource [02/13/18, via imaging resource]
Panasonic ZS200 Review The camera offers face/eye detection, subject tracking, custom multi, pinpoint autofocus and allows for the use of the touchscreen to move the AF point throughout the frame. In our review for the ZS100, we found that the autofocus was fast during real [...]

Eye Frames Per Second

Frame rate (also known as frame frequency) is the frequency (rate) at which an imaging device produces unique consecutive images called frames. The term applies equally well to computer graphics, video cameras, film cameras, and motion capture systems. Frame rate is most often expressed in frames per second (FPS) and is also expressed in progressive scan monitors as hertz (Hz).
The human eye and its brain interface, the human visual system, can process 10 to 12 separate images per second, perceiving them individually. The visual cortex holds onto one image for about one-fifteenth of a second, so if another image is received during that period an illusion of continuity is created, allowing a sequence of still images to give the impression of motion. Early silent films had a frame...

Source: Freebase, licensed under CC-BY.

By the Numbers: #Sixteen. The sum of the first four #odd #numbers. 1+3+5+7 = 16 2⁴ = 4² The #human #eye sees con… t.co/nDzxRJpsXE 

RT @TrackmanMaestro: Tom Brady....the GREATEST of all time...listening to SCIENTISTS and a coach that teaches him how to throw. Using TECHN…

RT @TrackmanMaestro: Tom Brady....the GREATEST of all time...listening to SCIENTISTS and a coach that teaches him how to throw. Using TECHN…

RT @TrackmanMaestro: Tom Brady....the GREATEST of all time...listening to SCIENTISTS and a coach that teaches him how to throw. Using TECHN…

Tom Brady....the GREATEST of all time...listening to SCIENTISTS and a coach that teaches him how to throw. Using TE… t.co/QH9mdF4awO 

Popular Photography - ND Popular Photography - ND
1950
ISBN
248 pages
Popular Photography - ND Popular Photography - ND
1951
ISBN
216 pages
Introduction to Light Introduction to Light
Published by Courier Corporation 2016
ISBN 048642118X,9780486421186
228 pages
Popular Photography - ND Popular Photography - ND
1948
ISBN
260 pages

Sony to deliver PlayStation VR in October

art vancouver gallery photographer science ron anatomy facebook nutrition intensive effective classschedule twitter sombilon bishnughosh photographyistheprocess activityandartofcreatingstillormovingpicturesbyrecordingradiationonaradiationsensitivemedium suchasaphotographicfilm oranelectronicsensorlightpatternsreflectedoremittedfromobjectsactivateasensitivechemicalorelectronicsensorduringatimedexposure usuallythroughaphotographiclensinadeviceknownasacamerathatalsostorestheresultinginformationchemicallyorelectronicallyphotographyhasmanyusesforbusiness togethermeaningdrawingwithlight1traditionally theproductsofphotographyhavebeencallednegativesandphotographs commonlyshortenedtophotosfunctionthecameraorcameraobscuraistheimageformingdevice andphotographicfilmorasiliconelectronicimagesensoristhesensingmediumtherespectiverecordingmediumcanbethefilmitself oradigitalelectronicormagneticmemoryphotographerscontrolthecameraandlenstoexposethelightrecordingmaterialsuchasfilmtotherequiredamountoflighttoformalatentimageonfilmorrawfileindigitalcameraswhich afterappropriateprocessing isconvertedtoausableimagedigitalcamerasuseanelectronicimagesensorbasedonlightsensitiveelectronicssuchaschargecoupleddeviceccdorcomplementarymetaloxidesemiconductorcmostechnologytheresultingdigitalimageisstoredele butcanbereproducedonpaperorfilmthemoviecameraisatypeofphotographiccamerawhichtakesarapidsequenceofphotographsonstripsoffilmincontrasttoastillcamera whichcapturesasinglesnapshotatatime themoviecameratakesaseriesofimages eachcalledaframethisisaccomplishedthroughanintermittentmechanismtheframesarelaterplayedbackinamovieprojectorataspecificspeed calledtheframeratenumberofframespersecondwhileviewing apersonseyesandbrainmergetheseparatepicturestogethertocreatetheillusionofmotion2inallbutcertainspecializedcameras theprocessofobtainingausableexposuremustinvolvetheuse manuallyorautomatically ofafewcontrolstoensurethephotographisclear sharpandwellilluminatedthecontrolsusuallyincludebutarenotlimitedtothefollowing commonlyknownashotyoga yogirajbikramchoudhuryisthefounderoftheworldwideyogacollegeofindia™bornincalcuttain1946 bikrambeganyogaattheageoffourwithindiasmostrenownedphysicalculturistatthattime theyoungerbrotherofparamahansayoganandaauthorofthemostpopularbookonyoga theautobiographyofayogi andfounderoftheselfrealizationfellowshipinlosangelesbikrampracticedyogaatleastfourtosixhourseverydayatghoshscollegeofphysicaleducationincalcuttaattheageofthirteen hewonthenationalindiayogachampionshiphewasundefeatedforthefollowingthreeyearsandretiredastheundisputedallindianationalyogachampionatseventeen aninjurytohiskneeduringaweightliftingaccidentbroughtthepredictionfromleadingeuropeandoctorsthathewouldneverwalkagainnotacceptingtheirpronouncement hehadhimselfcarriedbacktobishnughoshsschool forheknewthatifanyonecouldhelptohealhisknee itwashisteachersixmonthslater thefreeencyclopediabikramyoga isasystemofyogathatbikramchoudhurysynthesizedfromtraditionalyogatechniquesandpopularizedbeginninginenwikipediaorgwikibikramyogacachedsimilarultimatehealthwithbikramyogainformationonlocation andcostvancouverwwwbikramyogavancouvercomcachedsimilar bikramyogateachertrainingprogramisthemostexciting amusingandglamorousyogaclassintheworldspendnineweeksimmersedinanindepthstudyofbikramyogawithyogamastersbikramandrajashreechoudhuryandtheirstaffofseniorteachersthecourse leadingtoacertificateofcompletion willintroduceyoutothebasicknowledgeneededtobeginteachingthispowerfulhealingyogathecoursecoversasana therapeuticapplicationsandhealthbenefitsofyoga philosophyofyoga bikramspostureclinic andthebikramyogadialoguethroughdedicatedpracticeandstudyofthe26postures youwillexpandyourknowledgeofthebikrammethodandprepareyourselftoteachit httpwwwmsnbcmsncomid21134540vp4276327942763279 Photo by SOMBILON PHOTOGRAPHY | GALLERY | VIDEOGRAPHY on Flickr

By the end of the year — indeed, by Christmas time — it’s highly possible that we’ll see virtual reality become the new present battleground, because Sony is about to join the other gaming players that are Oculus and HTC with its own virtual... But while Oculus and the power-team of HTC and Valve will require a pretty highly spec’d computer to make its VR headsets work, Sony’s aptly named PlayStation VR will require only the aforementioned VR helmet and a PlayStation 4. Once you have...

[via Gadget Guy Australia]

IKEA thoughts and some of my favorite items from IKEA

wood autumn tree love nature germany deutschland ngc herbst natur arbres 25 e topf fv10 faves rhine wald rhein arbre baum breathtaking tra lorch sogno myheart wow1 wow2 wow3 mfcc realta welcometoparadise supershot topshots 3000v120f naturepoetry frameit top20clonepics supershots wasset asquare energiapositiva highqualityimages natureselegantshots 100commentgroup thebestofmimamorsgroups astrattoedintorni energiapositivanatureza umolhovêooutrosente virgiliocompany mygearandmesilver mygearandmegold mygearandmeplatinum mygearandmediamond wowbrilliant asquarelegend lélitedespaysages cluboftheprestigecolorfullandscapecreativeoutburstscreativephotogroupdontworrybehappydoublethebeautydoubledbeautiesdramajoinusdreams uniquementlordbyronlovewithgoldribbonslovelyuniversemagicunicornmagicalmomentsmeupaísémuseed’artmodernemuseumqualityonlymysoul myartnaturenaturesprimenaturesprimehalloffamenewgoldsealofqualityonlylandscapeandsunsetpanemetcircensespeacetookovermyheartphotogallerypioneerincreativity goldenachievement lifeearthcreatesearthnatureloveecoledesbeauxartselegantphotoartexcellentexpositiodesartscontemporainextraordinarilyimpressivefantasticnaturegalleryfavoritesthebestphotosfeedthesoulfinestgoldfinestnatu fleursetpaysagesflickrdiamondflickrbronzesilvergoldtrophygroupflickrspictureperfectflickrsfav250forgottentreasuresfrancostopgallerygalleryofdreamsgoldsealingshealinglightofthespiritineedatreeiwannabe magicmomentsinyourlife me2youphotographylevel1 vpu2 vpu3 vpu9 vpu10 frameitlevel3 frameitlevel2 frameitlevel4 frameitlevel5 frameitlevel6 frameitlevel7 Photo by Mister-Mastro on Flickr

I wasn't really sure what all the hype was about because from my knowledge, IKEA was the place were you bought cheap particle board furniture. I still don't like all the particle board stuff but my opinions have changed when I realized they have a lot more to offer than cheap tables and bookshelves. Over the past three years, I have purchased some IKEA stuff that I am a big fan of and there are still some other things that I have my eye on (looking to add to a registry perhaps. I got it to put over my white duvet that I had got from my grandma when she got a smaller bed. I was wary of the white color but have kept it clean by avoiding eating in bed and doing homework on bed. I have some holding miscellaneous craft supplies and some holding pasta. They are great for storing kitchen items like pasta and pretzels but I wouldn't recommend them for.

[via Sent by Sarah]

[03/15/16, via SpaceRef]
Stunning Video: Solar Dynamics Observatory Year 6 Ultra-HD Launched on Feb. 11, 2010, SDO keeps a 24-hour eye on the entire disk of the sun ... At full quality on YouTube, this video is ultra-high definition 3840x2160 and 29.97 frames per second. Each frame represents 2 hours. A downloadable version has a frame ... [...]

[03/15/16, via Gamasutra]
Shiny: From Oculus Rift to GearVR You want your app to run with 75 frames/second, especially if you use the Oculus Rift pointer ... So all in all just try to be below 13.3 milliseconds per frame. When using the Unity Inspector and looking out for spikes in the framerate, you will often ... [...]

[03/15/16, via What Culture]
11 Totally Mesmerising Slow-Mo Videos Normal footage is recorded at around 24 frames-per-second. High speed cameras can capture as many ... kind of exquisite detail that just wouldn’t be possible with the naked eye. Plus, it looks really cool when you blow things up. They’re always doing ... [...]

[03/13/16, via MENAFN]
iXCC Releases New Professional Gaming Mouse Offering 6600 frames per second and smooth and responsive tracking to deliver an ... MENA News Headlines Mar 12 2016 - Egypt- CI Capital, Beltone eye acquisition of electronic brokerage company, Daily News Egypt (MENAFN - Daily News Egypt) Following ... [...]

[03/13/16, via Mashable]
Voxiebox makes virtual reality without goggles Unless, that is, you're using Voxiebox, which employs biology and physics to create live holograms that you can see with your naked eye, walk around ... up and down at a rate of roughly 3,000 frames per second. Suddenly, in place of the screen is a ... [...]

Dragon Ball FighterZ - Release Date, Price, Gameplay, Story Timeline, All Confirmed Characters - Everything we Know

Dragon Ball FighterZ is set to arrive on consoles in early 2018, bringing with it a slew of fan-favorite characters from across the Dragon Ball anime and manga series. In this Dragon Ball FighterZ guide, we'll be going over absolutely everything you need to know about the upcoming fighting game, including all the confirmed Dragon Ball FighterZ characters so far, as well as graphics and gameplay.Dragon Ball FighterZ Release Date and PlatformsThe Dragon Ball FighterZ release date on PlayStation...

Panasonic's GH5s is the ultimate mirrorless camera for 4K video

The GH5 has been a video-centric camera since its debut, but Panasonic is pushing that into new territory with the launch of the GH5s mirrorless. Aimed specifically at videographers, it has a 10.2-megapixel "dual ISO" sensor with half the resolution of the 20.2-megapixel GH5. That gives it much better low-light sensitivity (up to ISO 51,200 native and 204,800 extended), and there's a full sensor readout at up to Cinema 4K resolution (2,160 x 4,096) video, at 60 frames per second.Just about...

Intel RealSense Depth Camera D415 & D435 review

In recent years the humble webcam has enjoyed something of a renaissance. Thanks to the proliferation of streaming and vlogging, there’s now a need for better cameras with more high-tech features. Webcam manufacturers have responded by putting out tons of affordable, high-quality cams designed for professional broadcasting use, and companies like Razer are even releasing streamer-centric cams with built in light fixtures.But Intel has entered the premium-webcam arena with something of an...