Latest Video

So wait...what's the frame rate of our eyes?

Cameras, movies, computers, and televisions all work on the principle of frames to create the illusion of motion. So...what about our eyes? Do they have a frame ...

News & Reviews

[09/10/18, via ]
This RSS feed URL is deprecated [...]

[09/10/18, via Newswise (press release)]
Blast tube tests at Sandia simulate shock wave conditions nuclear weapons could face Credit: Courtesy of Sandia National Laboratories. Sandia National Laboratories researchers use wavefront imaging taken at 35,000 frames per second to analyze blast wave dynamics invisible to the eye and determine how well nuclear weapons could  [...]

Digital Trends [09/06/18, via Digital Trends]
New sensor, 4K at 60 fps make Fujifilm's X-T3 a drool-worthy camera With a new sensor, processor, autofocus system, and electronic viewfinder, the Fujifilm's latest camera is anything but a minor update. On September 6, Fujifilm debuted the X-T3, a mirrorless camera that improves on multiple aspects of the already  [...]

Mashable [08/29/18, via Mashable]
Acer adds built-in eye-tracking to its powerful StarVR One headset It's still got the same 5K-resolution, super fast 90 frames per second refresh rate, and 210-degree horizontal and 130-degree vertical field of view (FOV) as the original StarVR headset. Just for comparison's sake, the Oculus Rift and even the newer [...]

[08/16/18, via Tech Times]
StarVR One Virtual Reality Headset Unveiled: Eye-Tracking, Nearly Human Field Of View, 90 FPS, And More The StarVR One proved to be the real deal as it is equipped with an eye tracking attribute as well as visuals working at 90 frames per second and a field of view that almost covers the entire human vision. Geared with 5.4 million pixels on display, the [...]

Eye Frames Per Second

Frame rate (also known as frame frequency) is the frequency (rate) at which an imaging device produces unique consecutive images called frames. The term applies equally well to computer graphics, video cameras, film cameras, and motion capture systems. Frame rate is most often expressed in frames per second (FPS) and is also expressed in progressive scan monitors as hertz (Hz).
The human eye and its brain interface, the human visual system, can process 10 to 12 separate images per second, perceiving them individually. The visual cortex holds onto one image for about one-fifteenth of a second, so if another image is received during that period an illusion of continuity is created, allowing a sequence of still images to give the impression of motion. Early silent films had a frame...

Source: Freebase, licensed under CC-BY.

@Tech/#Cognitive/#Vision/How many frames per second can the eyes really see?. Firstly, we perceive aspects of visio… 

@JulianCrossfire @Thekidwithaname Golden eye would be pretty good if the multiplayer didn't run at -15 frames per second

Did you know that the human eye can only see 30 frames per second?

@Chino20602 @CrossLeaks Your eye doesn’t use frames per second, a frame is a video

@NFEN tHe HuMaN eYe CaN oNlY sEe 30 FrAmEs PeR sEcOnD

Popular Photography - ND Popular Photography - ND
248 pages
Popular Photography - ND Popular Photography - ND
216 pages
Introduction to Light Introduction to Light
Published by Courier Corporation 2016
ISBN 048642118X,9780486421186
228 pages
Popular Photography - ND Popular Photography - ND
260 pages

Sony to deliver PlayStation VR in October

art vancouver gallery photographer science ron anatomy facebook nutrition intensive effective classschedule twitter sombilon bishnughosh photographyistheprocess activityandartofcreatingstillormovingpicturesbyrecordingradiationonaradiationsensitivemedium suchasaphotographicfilm oranelectronicsensorlightpatternsreflectedoremittedfromobjectsactivateasensitivechemicalorelectronicsensorduringatimedexposure usuallythroughaphotographiclensinadeviceknownasacamerathatalsostorestheresultinginformationchemicallyorelectronicallyphotographyhasmanyusesforbusiness togethermeaningdrawingwithlight1traditionally theproductsofphotographyhavebeencallednegativesandphotographs commonlyshortenedtophotosfunctionthecameraorcameraobscuraistheimageformingdevice andphotographicfilmorasiliconelectronicimagesensoristhesensingmediumtherespectiverecordingmediumcanbethefilmitself oradigitalelectronicormagneticmemoryphotographerscontrolthecameraandlenstoexposethelightrecordingmaterialsuchasfilmtotherequiredamountoflighttoformalatentimageonfilmorrawfileindigitalcameraswhich afterappropriateprocessing isconvertedtoausableimagedigitalcamerasuseanelectronicimagesensorbasedonlightsensitiveelectronicssuchaschargecoupleddeviceccdorcomplementarymetaloxidesemiconductorcmostechnologytheresultingdigitalimageisstoredele butcanbereproducedonpaperorfilmthemoviecameraisatypeofphotographiccamerawhichtakesarapidsequenceofphotographsonstripsoffilmincontrasttoastillcamera whichcapturesasinglesnapshotatatime themoviecameratakesaseriesofimages eachcalledaframethisisaccomplishedthroughanintermittentmechanismtheframesarelaterplayedbackinamovieprojectorataspecificspeed calledtheframeratenumberofframespersecondwhileviewing apersonseyesandbrainmergetheseparatepicturestogethertocreatetheillusionofmotion2inallbutcertainspecializedcameras theprocessofobtainingausableexposuremustinvolvetheuse manuallyorautomatically ofafewcontrolstoensurethephotographisclear sharpandwellilluminatedthecontrolsusuallyincludebutarenotlimitedtothefollowing commonlyknownashotyoga yogirajbikramchoudhuryisthefounderoftheworldwideyogacollegeofindia™bornincalcuttain1946 bikrambeganyogaattheageoffourwithindiasmostrenownedphysicalculturistatthattime theyoungerbrotherofparamahansayoganandaauthorofthemostpopularbookonyoga theautobiographyofayogi andfounderoftheselfrealizationfellowshipinlosangelesbikrampracticedyogaatleastfourtosixhourseverydayatghoshscollegeofphysicaleducationincalcuttaattheageofthirteen hewonthenationalindiayogachampionshiphewasundefeatedforthefollowingthreeyearsandretiredastheundisputedallindianationalyogachampionatseventeen aninjurytohiskneeduringaweightliftingaccidentbroughtthepredictionfromleadingeuropeandoctorsthathewouldneverwalkagainnotacceptingtheirpronouncement hehadhimselfcarriedbacktobishnughoshsschool forheknewthatifanyonecouldhelptohealhisknee itwashisteachersixmonthslater thefreeencyclopediabikramyoga isasystemofyogathatbikramchoudhurysynthesizedfromtraditionalyogatechniquesandpopularizedbeginninginenwikipediaorgwikibikramyogacachedsimilarultimatehealthwithbikramyogainformationonlocation andcostvancouverwwwbikramyogavancouvercomcachedsimilar bikramyogateachertrainingprogramisthemostexciting amusingandglamorousyogaclassintheworldspendnineweeksimmersedinanindepthstudyofbikramyogawithyogamastersbikramandrajashreechoudhuryandtheirstaffofseniorteachersthecourse leadingtoacertificateofcompletion willintroduceyoutothebasicknowledgeneededtobeginteachingthispowerfulhealingyogathecoursecoversasana therapeuticapplicationsandhealthbenefitsofyoga philosophyofyoga bikramspostureclinic andthebikramyogadialoguethroughdedicatedpracticeandstudyofthe26postures youwillexpandyourknowledgeofthebikrammethodandprepareyourselftoteachit httpwwwmsnbcmsncomid21134540vp4276327942763279 Photo by SOMBILON PHOTOGRAPHY | GALLERY | VIDEOGRAPHY on Flickr

By the end of the year — indeed, by Christmas time — it’s highly possible that we’ll see virtual reality become the new present battleground, because Sony is about to join the other gaming players that are Oculus and HTC with its own virtual... But while Oculus and the power-team of HTC and Valve will require a pretty highly spec’d computer to make its VR headsets work, Sony’s aptly named PlayStation VR will require only the aforementioned VR helmet and a PlayStation 4. Once you have...

[via Gadget Guy Australia]

IKEA thoughts and some of my favorite items from IKEA

wood autumn tree love nature germany deutschland ngc herbst natur arbres 25 e topf fv10 faves rhine wald rhein arbre baum breathtaking tra lorch sogno myheart wow1 wow2 wow3 mfcc realta welcometoparadise supershot topshots 3000v120f naturepoetry frameit top20clonepics supershots wasset asquare energiapositiva highqualityimages natureselegantshots 100commentgroup thebestofmimamorsgroups astrattoedintorni energiapositivanatureza umolhovêooutrosente virgiliocompany mygearandmesilver mygearandmegold mygearandmeplatinum mygearandmediamond wowbrilliant asquarelegend lélitedespaysages cluboftheprestigecolorfullandscapecreativeoutburstscreativephotogroupdontworrybehappydoublethebeautydoubledbeautiesdramajoinusdreams uniquementlordbyronlovewithgoldribbonslovelyuniversemagicunicornmagicalmomentsmeupaísémuseed’artmodernemuseumqualityonlymysoul myartnaturenaturesprimenaturesprimehalloffamenewgoldsealofqualityonlylandscapeandsunsetpanemetcircensespeacetookovermyheartphotogallerypioneerincreativity goldenachievement lifeearthcreatesearthnatureloveecoledesbeauxartselegantphotoartexcellentexpositiodesartscontemporainextraordinarilyimpressivefantasticnaturegalleryfavoritesthebestphotosfeedthesoulfinestgoldfinestnatu fleursetpaysagesflickrdiamondflickrbronzesilvergoldtrophygroupflickrspictureperfectflickrsfav250forgottentreasuresfrancostopgallerygalleryofdreamsgoldsealingshealinglightofthespiritineedatreeiwannabe magicmomentsinyourlife me2youphotographylevel1 vpu2 vpu3 vpu9 vpu10 frameitlevel3 frameitlevel2 frameitlevel4 frameitlevel5 frameitlevel6 frameitlevel7 Photo by Mister-Mastro on Flickr

I wasn't really sure what all the hype was about because from my knowledge, IKEA was the place were you bought cheap particle board furniture. I still don't like all the particle board stuff but my opinions have changed when I realized they have a lot more to offer than cheap tables and bookshelves. Over the past three years, I have purchased some IKEA stuff that I am a big fan of and there are still some other things that I have my eye on (looking to add to a registry perhaps. I got it to put over my white duvet that I had got from my grandma when she got a smaller bed. I was wary of the white color but have kept it clean by avoiding eating in bed and doing homework on bed. I have some holding miscellaneous craft supplies and some holding pasta. They are great for storing kitchen items like pasta and pretzels but I wouldn't recommend them for.

[via Sent by Sarah]

[03/15/16, via SpaceRef]
Stunning Video: Solar Dynamics Observatory Year 6 Ultra-HD Launched on Feb. 11, 2010, SDO keeps a 24-hour eye on the entire disk of the sun ... At full quality on YouTube, this video is ultra-high definition 3840x2160 and 29.97 frames per second. Each frame represents 2 hours. A downloadable version has a frame ... [...]

[03/15/16, via Gamasutra]
Shiny: From Oculus Rift to GearVR You want your app to run with 75 frames/second, especially if you use the Oculus Rift pointer ... So all in all just try to be below 13.3 milliseconds per frame. When using the Unity Inspector and looking out for spikes in the framerate, you will often ... [...]

[03/15/16, via What Culture]
11 Totally Mesmerising Slow-Mo Videos Normal footage is recorded at around 24 frames-per-second. High speed cameras can capture as many ... kind of exquisite detail that just wouldn’t be possible with the naked eye. Plus, it looks really cool when you blow things up. They’re always doing ... [...]

[03/12/16, via MENAFN]
iXCC Releases New Professional Gaming Mouse Offering 6600 frames per second and smooth and responsive tracking to deliver an ... MENA News Headlines Mar 12 2016 - Egypt- CI Capital, Beltone eye acquisition of electronic brokerage company, Daily News Egypt (MENAFN - Daily News Egypt) Following ... [...]

[03/12/16, via Mashable]
Voxiebox makes virtual reality without goggles Unless, that is, you're using Voxiebox, which employs biology and physics to create live holograms that you can see with your naked eye, walk around ... up and down at a rate of roughly 3,000 frames per second. Suddenly, in place of the screen is a ... [...]

Dragon Ball FighterZ - Release Date, Price, Gameplay, Story Timeline, All Confirmed Characters - Everything we Know

Dragon Ball FighterZ is set to arrive on consoles in early 2018, bringing with it a slew of fan-favorite characters from across the Dragon Ball anime and manga series. In this Dragon Ball FighterZ guide, we'll be going over absolutely everything you need to know about the upcoming fighting game, including all the confirmed Dragon Ball FighterZ characters so far, as well as graphics and gameplay.Dragon Ball FighterZ Release Date and PlatformsThe Dragon Ball FighterZ release date on PlayStation...

Panasonic's GH5s is the ultimate mirrorless camera for 4K video

The GH5 has been a video-centric camera since its debut, but Panasonic is pushing that into new territory with the launch of the GH5s mirrorless. Aimed specifically at videographers, it has a 10.2-megapixel "dual ISO" sensor with half the resolution of the 20.2-megapixel GH5. That gives it much better low-light sensitivity (up to ISO 51,200 native and 204,800 extended), and there's a full sensor readout at up to Cinema 4K resolution (2,160 x 4,096) video, at 60 frames per second.Just about...

Intel RealSense Depth Camera D415 & D435 review

In recent years the humble webcam has enjoyed something of a renaissance. Thanks to the proliferation of streaming and vlogging, there’s now a need for better cameras with more high-tech features. Webcam manufacturers have responded by putting out tons of affordable, high-quality cams designed for professional broadcasting use, and companies like Razer are even releasing streamer-centric cams with built in light fixtures.But Intel has entered the premium-webcam arena with something of an...